SPR purified MaxPab mouse polyclonal antibody (B01P)
  • SPR purified MaxPab mouse polyclonal antibody (B01P)

SPR purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006697-B01P
SPR purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPR protein.
Información adicional
Size 50 ug
Gene Name SPR
Gene Alias SDR38C1
Gene Description sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSGLRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQVNNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPR (AAH17310.1, 1 a.a. ~ 261 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6697

Enviar uma mensagem


SPR purified MaxPab mouse polyclonal antibody (B01P)

SPR purified MaxPab mouse polyclonal antibody (B01P)