SPR polyclonal antibody (A01)
  • SPR polyclonal antibody (A01)

SPR polyclonal antibody (A01)

Ref: AB-H00006697-A01
SPR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPR.
Información adicional
Size 50 uL
Gene Name SPR
Gene Alias SDR38C1
Gene Description sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq FKGWALYCAGKAARDMLFQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQKLLSLLEKDEFKSGAHVDFYD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPR (NP_003115, 164 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6697

Enviar uma mensagem


SPR polyclonal antibody (A01)

SPR polyclonal antibody (A01)