SPP1 polyclonal antibody (A01)
  • SPP1 polyclonal antibody (A01)

SPP1 polyclonal antibody (A01)

Ref: AB-H00006696-A01
SPP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPP1.
Información adicional
Size 50 uL
Gene Name SPP1
Gene Alias BNSP|BSPI|ETA-1|MGC110940|OPN
Gene Description secreted phosphoprotein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SVVYGLRSKSKKFRRPDIQYPDATDEDITSHMESEELNGAYKAIPVAQDLNAPSDWDSRGKDSYETSQLDDQSAETHSHKQSRLYKRKANDESNEHSDVIDSQELSKVSR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPP1 (NP_000573, 148 a.a. ~ 257 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6696

Enviar uma mensagem


SPP1 polyclonal antibody (A01)

SPP1 polyclonal antibody (A01)