SPN purified MaxPab mouse polyclonal antibody (B01P)
  • SPN purified MaxPab mouse polyclonal antibody (B01P)

SPN purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006693-B01P
SPN purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SPN protein.
Información adicional
Size 50 ug
Gene Name SPN
Gene Alias CD43|GPL115|LSN
Gene Description sialophorin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Tr
Immunogen Prot. Seq MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGSPLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAPVTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSSVKLSTMMSPTTSTNASTVPFRNPDENSRGM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPN (NP_003114.1, 1 a.a. ~ 400 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6693

Enviar uma mensagem


SPN purified MaxPab mouse polyclonal antibody (B01P)

SPN purified MaxPab mouse polyclonal antibody (B01P)