SPINK1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SPINK1 purified MaxPab rabbit polyclonal antibody (D01P)

SPINK1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006690-D01P
SPINK1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SPINK1 protein.
Información adicional
Size 100 ug
Gene Name SPINK1
Gene Alias PCTT|PSTI|Spink3|TATI
Gene Description serine peptidase inhibitor, Kazal type 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SPINK1 (NP_003113.2, 1 a.a. ~ 79 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6690

Enviar uma mensagem


SPINK1 purified MaxPab rabbit polyclonal antibody (D01P)

SPINK1 purified MaxPab rabbit polyclonal antibody (D01P)