SPAST monoclonal antibody (M02), clone 2F5
  • SPAST monoclonal antibody (M02), clone 2F5

SPAST monoclonal antibody (M02), clone 2F5

Ref: AB-H00006683-M02
SPAST monoclonal antibody (M02), clone 2F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SPAST.
Información adicional
Size 100 ug
Gene Name SPAST
Gene Alias ADPSP|FSP2|KIAA1083|SPG4
Gene Description spastin
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,ELISA,IF
Immunogen Prot. Seq PVLPFSKSQTDVYNDSTNLACRNGHLQSESGAVPKRKDPLTHTSNSLPRSKTVMKTGSAGLSGHHRAPSYSGLSMVSGVKQGSGPAPTTHKGTPKTNRTNKPSTP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPAST (NP_055761, 200 a.a. ~ 304 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6683
Clone Number 2F5
Iso type IgG1 Kappa

Enviar uma mensagem


SPAST monoclonal antibody (M02), clone 2F5

SPAST monoclonal antibody (M02), clone 2F5