UAP1 monoclonal antibody (M01), clone 3A9 View larger

Mouse monoclonal antibody raised against a partial recombinant UAP1.

AB-H00006675-M01

New product

UAP1 monoclonal antibody (M01), clone 3A9

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name UAP1
Gene Alias AGX1|AgX|SPAG2
Gene Description UDP-N-acteylglucosamine pyrophosphorylase 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LKNADSQNGKDNPTTARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPLIIDENGVHELVKNG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UAP1 (NP_003106, 406 a.a. ~ 504 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6675
Clone Number 3A9
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant UAP1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant UAP1.

Mouse monoclonal antibody raised against a partial recombinant UAP1.