SP100 monoclonal antibody (M03), clone 2E2
  • SP100 monoclonal antibody (M03), clone 2E2

SP100 monoclonal antibody (M03), clone 2E2

Ref: AB-H00006672-M03
SP100 monoclonal antibody (M03), clone 2E2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP100.
Información adicional
Size 100 ug
Gene Name SP100
Gene Alias DKFZp686E07254|FLJ00340|FLJ34579
Gene Description SP100 nuclear antigen
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTEDQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRDRDLITNKMFEDSQDSCRN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP100 (NP_003104, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6672
Clone Number 2E2
Iso type IgG2a Kappa

Enviar uma mensagem


SP100 monoclonal antibody (M03), clone 2E2

SP100 monoclonal antibody (M03), clone 2E2