SP3 monoclonal antibody (M21), clone 1G9
  • SP3 monoclonal antibody (M21), clone 1G9

SP3 monoclonal antibody (M21), clone 1G9

Ref: AB-H00006670-M21
SP3 monoclonal antibody (M21), clone 1G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP3.
Información adicional
Size 100 ug
Gene Name SP3
Gene Alias DKFZp686O1631|SPR-2
Gene Description Sp3 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP3 (NP_003102.1, 516 a.a. ~ 615 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6670
Clone Number 1G9
Iso type IgG2a Kappa

Enviar uma mensagem


SP3 monoclonal antibody (M21), clone 1G9

SP3 monoclonal antibody (M21), clone 1G9