SP3 monoclonal antibody (M07), clone 2E5
  • SP3 monoclonal antibody (M07), clone 2E5

SP3 monoclonal antibody (M07), clone 2E5

Ref: AB-H00006670-M07
SP3 monoclonal antibody (M07), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SP3.
Información adicional
Size 100 ug
Gene Name SP3
Gene Alias DKFZp686O1631|SPR-2
Gene Description Sp3 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq TAGINADGHLINTGQAMDSSDNSERTGERVSPDINETNTDTDLFVPTSSSSQLPVTIDSTGILQQNTNSLTTSSGQVHSSDLQGNYIQSPVSEETQAQNIQVSTAQPVVQHLQLQESQQPTSQAQIVQGITPQTIHGVQASGQN*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP3 (NP_003102, 287 a.a. ~ 430 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6670
Clone Number 2E5
Iso type IgG2a Kappa

Enviar uma mensagem


SP3 monoclonal antibody (M07), clone 2E5

SP3 monoclonal antibody (M07), clone 2E5