SP2 monoclonal antibody (M01), clone 5D3
  • SP2 monoclonal antibody (M01), clone 5D3

SP2 monoclonal antibody (M01), clone 5D3

Ref: AB-H00006668-M01
SP2 monoclonal antibody (M01), clone 5D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP2.
Información adicional
Size 100 ug
Gene Name SP2
Gene Alias -
Gene Description Sp2 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SPGKNSFGILSSKGNILQIQGSQLSASYPGGQLVFAIQNPTMINKGTRSNANIQYQAVPQIQASNSQTIQVQPNLTNQIQIIPGTNQAIIT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP2 (NP_003101.2, 71 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6668
Clone Number 5D3
Iso type IgG2a Kappa

Enviar uma mensagem


SP2 monoclonal antibody (M01), clone 5D3

SP2 monoclonal antibody (M01), clone 5D3