SP1 monoclonal antibody (M11), clone 1G9
  • SP1 monoclonal antibody (M11), clone 1G9

SP1 monoclonal antibody (M11), clone 1G9

Ref: AB-H00006667-M11
SP1 monoclonal antibody (M11), clone 1G9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SP1.
Información adicional
Size 100 ug
Gene Name SP1
Gene Alias -
Gene Description Sp1 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq QLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSG*
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP1 (NP_612482, 522 a.a. ~ 618 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6667
Clone Number 1G9
Iso type IgG2a Kappa

Enviar uma mensagem


SP1 monoclonal antibody (M11), clone 1G9

SP1 monoclonal antibody (M11), clone 1G9