SP1 monoclonal antibody (M01), clone 4H6
  • SP1 monoclonal antibody (M01), clone 4H6

SP1 monoclonal antibody (M01), clone 4H6

Ref: AB-H00006667-M01
SP1 monoclonal antibody (M01), clone 4H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP1.
Información adicional
Size 100 ug
Gene Name SP1
Gene Alias -
Gene Description Sp1 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP1 (NP_612482.2, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6667
Clone Number 4H6
Iso type IgG Mix Kappa

Enviar uma mensagem


SP1 monoclonal antibody (M01), clone 4H6

SP1 monoclonal antibody (M01), clone 4H6