SP1 polyclonal antibody (A01)
  • SP1 polyclonal antibody (A01)

SP1 polyclonal antibody (A01)

Ref: AB-H00006667-A01
SP1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SP1.
Información adicional
Size 50 uL
Gene Name SP1
Gene Alias -
Gene Description Sp1 transcription factor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GTGELDLTATQLSQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP1 (NP_612482, 89 a.a. ~ 198 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6667

Enviar uma mensagem


SP1 polyclonal antibody (A01)

SP1 polyclonal antibody (A01)