SOX12 polyclonal antibody (A01)
  • SOX12 polyclonal antibody (A01)

SOX12 polyclonal antibody (A01)

Ref: AB-H00006666-A01
SOX12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SOX12.
Información adicional
Size 50 uL
Gene Name SOX12
Gene Alias SOX22
Gene Description SRY (sex determining region Y)-box 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LGFLSRLPPGPAGLDCSALDRDPDLQPPSGTSHFEFPDYCTPEVTEMIAGDWRPSSIADLVF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX12 (NP_008874, 252 a.a. ~ 313 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6666

Enviar uma mensagem


SOX12 polyclonal antibody (A01)

SOX12 polyclonal antibody (A01)