SOX10 purified MaxPab mouse polyclonal antibody (B01P)
  • SOX10 purified MaxPab mouse polyclonal antibody (B01P)

SOX10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006663-B01P
SOX10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SOX10 protein.
Información adicional
Size 50 ug
Gene Name SOX10
Gene Alias DOM|MGC15649|WS2E|WS4
Gene Description SRY (sex determining region Y)-box 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPKTELQSGKAD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SOX10 (NP_008872.1, 1 a.a. ~ 466 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6663

Enviar uma mensagem


SOX10 purified MaxPab mouse polyclonal antibody (B01P)

SOX10 purified MaxPab mouse polyclonal antibody (B01P)