SOX9 monoclonal antibody (M04), clone 3F11
  • SOX9 monoclonal antibody (M04), clone 3F11

SOX9 monoclonal antibody (M04), clone 3F11

Ref: AB-H00006662-M04
SOX9 monoclonal antibody (M04), clone 3F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SOX9.
Información adicional
Size 100 ug
Gene Name SOX9
Gene Alias CMD1|CMPD1|SRA1
Gene Description SRY (sex determining region Y)-box 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6662
Clone Number 3F11
Iso type IgG1 Kappa

Enviar uma mensagem


SOX9 monoclonal antibody (M04), clone 3F11

SOX9 monoclonal antibody (M04), clone 3F11