SORL1 monoclonal antibody (M01), clone 3F2
  • SORL1 monoclonal antibody (M01), clone 3F2

SORL1 monoclonal antibody (M01), clone 3F2

Ref: AB-H00006653-M01
SORL1 monoclonal antibody (M01), clone 3F2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SORL1.
Información adicional
Size 100 ug
Gene Name SORL1
Gene Alias C11orf32|FLJ21930|FLJ39258|LR11|LRP9|SORLA|SorLA-1|gp250
Gene Description sortilin-related receptor, L(DLR class) A repeats-containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORL1 (NP_003096, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6653
Clone Number 3F2
Iso type IgG2b Kappa

Enviar uma mensagem


SORL1 monoclonal antibody (M01), clone 3F2

SORL1 monoclonal antibody (M01), clone 3F2