SORL1 polyclonal antibody (A01)
  • SORL1 polyclonal antibody (A01)

SORL1 polyclonal antibody (A01)

Ref: AB-H00006653-A01
SORL1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SORL1.
Información adicional
Size 50 uL
Gene Name SORL1
Gene Alias C11orf32|FLJ21930|FLJ39258|LR11|LRP9|SORLA|SorLA-1|gp250
Gene Description sortilin-related receptor, L(DLR class) A repeats-containing
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SORL1 (NP_003096, 82 a.a. ~ 181 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6653

Enviar uma mensagem


SORL1 polyclonal antibody (A01)

SORL1 polyclonal antibody (A01)