SOD1 monoclonal antibody (M04), clone 10D5
  • SOD1 monoclonal antibody (M04), clone 10D5

SOD1 monoclonal antibody (M04), clone 10D5

Ref: AB-H00006647-M04
SOD1 monoclonal antibody (M04), clone 10D5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SOD1.
Información adicional
Size 100 ug
Gene Name SOD1
Gene Alias ALS|ALS1|IPOA|SOD|homodimer
Gene Description superoxide dismutase 1, soluble
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SOD1 (AAH01034, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6647
Clone Number 10D5
Iso type IgG2a Kappa

Enviar uma mensagem


SOD1 monoclonal antibody (M04), clone 10D5

SOD1 monoclonal antibody (M04), clone 10D5