SNRPG monoclonal antibody (M02), clone 2F1-1F12
  • SNRPG monoclonal antibody (M02), clone 2F1-1F12

SNRPG monoclonal antibody (M02), clone 2F1-1F12

Ref: AB-H00006637-M02
SNRPG monoclonal antibody (M02), clone 2F1-1F12

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SNRPG.
Información adicional
Size 100 ug
Gene Name SNRPG
Gene Alias MGC117317|SMG
Gene Description small nuclear ribonucleoprotein polypeptide G
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNRPG (AAH00070, 1 a.a. ~ 76 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6637
Clone Number 2F1-1F12
Iso type IgG1 Kappa

Enviar uma mensagem


SNRPG monoclonal antibody (M02), clone 2F1-1F12

SNRPG monoclonal antibody (M02), clone 2F1-1F12