SNRPD2 polyclonal antibody (A01)
  • SNRPD2 polyclonal antibody (A01)

SNRPD2 polyclonal antibody (A01)

Ref: AB-H00006633-A01
SNRPD2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SNRPD2.
Información adicional
Size 50 uL
Gene Name SNRPD2
Gene Alias SMD2|SNRPD1
Gene Description small nuclear ribonucleoprotein D2 polypeptide 16.5kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNRPD2 (AAH00486, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6633

Enviar uma mensagem


SNRPD2 polyclonal antibody (A01)

SNRPD2 polyclonal antibody (A01)