SNCG monoclonal antibody (M01), clone 2C3
  • SNCG monoclonal antibody (M01), clone 2C3

SNCG monoclonal antibody (M01), clone 2C3

Ref: AB-H00006623-M01
SNCG monoclonal antibody (M01), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNCG.
Información adicional
Size 50 ug
Gene Name SNCG
Gene Alias BCSG1|SR
Gene Description synuclein, gamma (breast cancer-specific protein 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNCG (AAH14098, 21 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6623
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


SNCG monoclonal antibody (M01), clone 2C3

SNCG monoclonal antibody (M01), clone 2C3