SNCG purified MaxPab rabbit polyclonal antibody (D01P)
  • SNCG purified MaxPab rabbit polyclonal antibody (D01P)

SNCG purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006623-D01P
SNCG purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNCG protein.
Información adicional
Size 100 ug
Gene Name SNCG
Gene Alias BCSG1|SR
Gene Description synuclein, gamma (breast cancer-specific protein 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNCG (AAH14098.1, 1 a.a. ~ 127 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6623

Enviar uma mensagem


SNCG purified MaxPab rabbit polyclonal antibody (D01P)

SNCG purified MaxPab rabbit polyclonal antibody (D01P)