SNCA monoclonal antibody (M01), clone 2E4
  • SNCA monoclonal antibody (M01), clone 2E4

SNCA monoclonal antibody (M01), clone 2E4

Ref: AB-H00006622-M01
SNCA monoclonal antibody (M01), clone 2E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNCA.
Información adicional
Size 100 ug
Gene Name SNCA
Gene Alias MGC110988|NACP|PARK1|PARK4|PD1
Gene Description synuclein, alpha (non A4 component of amyloid precursor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq GKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNCA (NP_000336, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6622
Clone Number 2E4
Iso type IgG2a kappa

Enviar uma mensagem


SNCA monoclonal antibody (M01), clone 2E4

SNCA monoclonal antibody (M01), clone 2E4