SNCB monoclonal antibody (M07), clone 3H4
  • SNCB monoclonal antibody (M07), clone 3H4

SNCB monoclonal antibody (M07), clone 3H4

Ref: AB-H00006620-M07
SNCB monoclonal antibody (M07), clone 3H4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SNCB.
Información adicional
Size 100 ug
Gene Name SNCB
Gene Alias -
Gene Description synuclein, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNCB (AAH02902, 1 a.a. ~ 134 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6620
Clone Number 3H4
Iso type IgG2a Kappa

Enviar uma mensagem


SNCB monoclonal antibody (M07), clone 3H4

SNCB monoclonal antibody (M07), clone 3H4