SNAI1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SNAI1 purified MaxPab rabbit polyclonal antibody (D01P)

SNAI1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006615-D01P
SNAI1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SNAI1 protein.
Información adicional
Size 100 ug
Gene Name SNAI1
Gene Alias SLUGH2|SNA|SNAH|dJ710H13.1
Gene Description snail homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SNAI1 (NP_005976.2, 1 a.a. ~ 264 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6615

Enviar uma mensagem


SNAI1 purified MaxPab rabbit polyclonal antibody (D01P)

SNAI1 purified MaxPab rabbit polyclonal antibody (D01P)