SUMO2 polyclonal antibody (A01)
  • SUMO2 polyclonal antibody (A01)

SUMO2 polyclonal antibody (A01)

Ref: AB-H00006613-A01
SUMO2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SUMO2.
Información adicional
Size 50 uL
Gene Name SUMO2
Gene Alias HSMT3|MGC117191|SMT3B|SMT3H2
Gene Description SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MADEKPKEGVKTENNNHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUMO2 (AAH08450, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6613

Enviar uma mensagem


SUMO2 polyclonal antibody (A01)

SUMO2 polyclonal antibody (A01)