SUMO3 polyclonal antibody (A01)
  • SUMO3 polyclonal antibody (A01)

SUMO3 polyclonal antibody (A01)

Ref: AB-H00006612-A01
SUMO3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SUMO3.
Información adicional
Size 50 uL
Gene Name SUMO3
Gene Alias SMT3A|SMT3H1|SUMO-3
Gene Description SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUMO3 (NP_008867, 1 a.a. ~ 103 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6612

Enviar uma mensagem


SUMO3 polyclonal antibody (A01)

SUMO3 polyclonal antibody (A01)