SMPD1 monoclonal antibody (M01), clone 4H2
  • SMPD1 monoclonal antibody (M01), clone 4H2

SMPD1 monoclonal antibody (M01), clone 4H2

Ref: AB-H00006609-M01
SMPD1 monoclonal antibody (M01), clone 4H2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SMPD1.
Información adicional
Size 100 ug
Gene Name SMPD1
Gene Alias ASM|NPD
Gene Description sphingomyelin phosphodiesterase 1, acid lysosomal
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLALALALALALALSDSRVLWAPAEAHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIKLCNLLKIAPPAVCRSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISLPTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASRPGAGYWGEYSKCDLPLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMPD1 (AAH41164, 1 a.a. ~ 364 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6609
Clone Number 4H2
Iso type IgG2a Kappa

Enviar uma mensagem


SMPD1 monoclonal antibody (M01), clone 4H2

SMPD1 monoclonal antibody (M01), clone 4H2