SMARCD3 monoclonal antibody (M01), clone 1G6
  • SMARCD3 monoclonal antibody (M01), clone 1G6

SMARCD3 monoclonal antibody (M01), clone 1G6

Ref: AB-H00006604-M01
SMARCD3 monoclonal antibody (M01), clone 1G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMARCD3.
Información adicional
Size 100 ug
Gene Name SMARCD3
Gene Alias BAF60C|CRACD3|MGC111010|Rsc6p
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6604
Clone Number 1G6
Iso type IgG2a Kappa

Enviar uma mensagem


SMARCD3 monoclonal antibody (M01), clone 1G6

SMARCD3 monoclonal antibody (M01), clone 1G6