SMARCD3 polyclonal antibody (A01)
  • SMARCD3 polyclonal antibody (A01)

SMARCD3 polyclonal antibody (A01)

Ref: AB-H00006604-A01
SMARCD3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMARCD3.
Información adicional
Size 50 uL
Gene Name SMARCD3
Gene Alias BAF60C|CRACD3|MGC111010|Rsc6p
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYVQDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVVRNT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCD3 (NP_001003801, 385 a.a. ~ 483 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6604

Enviar uma mensagem


SMARCD3 polyclonal antibody (A01)

SMARCD3 polyclonal antibody (A01)