View larger
Mouse monoclonal antibody raised against a partial recombinant SMARCD2.
AB-H00006603-M02
New product
SMARCD2 monoclonal antibody (M02), clone 2B2
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SMARCD2 |
| Gene Alias | BAF60B|CRACD2|PRO2451|Rsc6p |
| Gene Description | SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,ELISA,IF |
| Immunogen Prot. Seq | RDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SMARCD2 (NP_003068, 398 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6603 |
| Clone Number | 2B2 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant SMARCD2.