SMARCB1 monoclonal antibody (M13), clone 3B9
  • SMARCB1 monoclonal antibody (M13), clone 3B9

SMARCB1 monoclonal antibody (M13), clone 3B9

Ref: AB-H00006598-M13
SMARCB1 monoclonal antibody (M13), clone 3B9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SMARCB1.
Información adicional
Size 100 ug
Gene Name SMARCB1
Gene Alias BAF47|INI1|RDT|SNF5|SNF5L1|Sfh1p|Snr1|hSNFS
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq VPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCB1 (NP_002922, 123 a.a. ~ 202 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6598
Clone Number 3B9
Iso type IgG2b Kappa

Enviar uma mensagem


SMARCB1 monoclonal antibody (M13), clone 3B9

SMARCB1 monoclonal antibody (M13), clone 3B9