SMARCA4 polyclonal antibody (A01)
  • SMARCA4 polyclonal antibody (A01)

SMARCA4 polyclonal antibody (A01)

Ref: AB-H00006597-A01
SMARCA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SMARCA4.
Información adicional
Size 50 uL
Gene Name SMARCA4
Gene Alias BAF190|BRG1|FLJ39786|SNF2|SNF2-BETA|SNF2L4|SNF2LB|SWI2|hSNF2b
Gene Description SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq LSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMARCA4 (NP_003063, 1451 a.a. ~ 1550 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6597

Enviar uma mensagem


SMARCA4 polyclonal antibody (A01)

SMARCA4 polyclonal antibody (A01)