SLIT3 polyclonal antibody (A01)
  • SLIT3 polyclonal antibody (A01)

SLIT3 polyclonal antibody (A01)

Ref: AB-H00006586-A01
SLIT3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLIT3.
Información adicional
Size 50 uL
Gene Name SLIT3
Gene Alias FLJ10764|MEGF5|SLIL2|SLIT1|Slit-3|slit2
Gene Description slit homolog 3 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PCLGHRCHHGKCVATGTSYMCKCAEGYGGDLCDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLGQVVREVIRRQKGYASCATA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLIT3 (NP_003053, 1371 a.a. ~ 1470 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6586

Enviar uma mensagem


SLIT3 polyclonal antibody (A01)

SLIT3 polyclonal antibody (A01)