SLC22A4 polyclonal antibody (A01)
  • SLC22A4 polyclonal antibody (A01)

SLC22A4 polyclonal antibody (A01)

Ref: AB-H00006583-A01
SLC22A4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC22A4.
Información adicional
Size 50 uL
Gene Name SLC22A4
Gene Alias MGC34546|MGC40524|OCTN1
Gene Description solute carrier family 22 (organic cation/ergothioneine transporter), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC22A4 (NP_003050, 43 a.a. ~ 141 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6583

Enviar uma mensagem


SLC22A4 polyclonal antibody (A01)

SLC22A4 polyclonal antibody (A01)