SLC20A1 monoclonal antibody (M01), clone 6A9-F2
  • SLC20A1 monoclonal antibody (M01), clone 6A9-F2

SLC20A1 monoclonal antibody (M01), clone 6A9-F2

Ref: AB-H00006574-M01
SLC20A1 monoclonal antibody (M01), clone 6A9-F2

Información del producto

Mouse monoclonal antibody raised against a full length recombinant SLC20A1.
Información adicional
Size 100 ug
Gene Name SLC20A1
Gene Alias DKFZp686J2397|FLJ41426|GLVR1|Glvr-1|PIT1|PiT-1
Gene Description solute carrier family 20 (phosphate transporter), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MATLITSTTAATAASGPLVDYLWMLILGFIIAFVLAFSVGANDVANSFGTAVGSGVVTLKQACILASIFETVGSVLLGAKVSETIRKGLIDVEMYNSTQGLLMAGSVSAMFGSAVWQLVASFLKLPISGTHCIVGATIGFSLVAKGQEGVKWSELIKIVMSWFVSPLLSGIMSGILFFLVRAFILHKADPVPNGLRALPVFYACTVGINLFSIMYTGAPLLGFDKLPLWGTILISVGCAVFCALIVWFFVCPRMK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC20A1 (AAH19944, 1 a.a. ~ 679 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6574
Clone Number 6A9-F2
Iso type IgG2a kappa

Enviar uma mensagem


SLC20A1 monoclonal antibody (M01), clone 6A9-F2

SLC20A1 monoclonal antibody (M01), clone 6A9-F2