SLC18A2 polyclonal antibody (A01)
  • SLC18A2 polyclonal antibody (A01)

SLC18A2 polyclonal antibody (A01)

Ref: AB-H00006571-A01
SLC18A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC18A2.
Información adicional
Size 50 uL
Gene Name SLC18A2
Gene Alias MGC120477|MGC120478|MGC26538|SVAT|SVMT|VAT2|VMAT2
Gene Description solute carrier family 18 (vesicular monoamine), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq HEKNATEIQTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKATVQLITNPFIGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC18A2 (NP_003045, 53 a.a. ~ 151 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6571

Enviar uma mensagem


SLC18A2 polyclonal antibody (A01)

SLC18A2 polyclonal antibody (A01)