SLC16A1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC16A1 purified MaxPab rabbit polyclonal antibody (D01P)

SLC16A1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006566-D01P
SLC16A1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC16A1 protein.
Información adicional
Size 100 ug
Gene Name SLC16A1
Gene Alias FLJ36745|HHF7|MCT|MCT1|MGC44475
Gene Description solute carrier family 16, member 1 (monocarboxylic acid transporter 1)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSWISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIGGLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLILGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC16A1 (P53985, 1 a.a. ~ 500 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6566

Enviar uma mensagem


SLC16A1 purified MaxPab rabbit polyclonal antibody (D01P)

SLC16A1 purified MaxPab rabbit polyclonal antibody (D01P)