SLC12A4 monoclonal antibody (M01), clone 1H6
  • SLC12A4 monoclonal antibody (M01), clone 1H6

SLC12A4 monoclonal antibody (M01), clone 1H6

Ref: AB-H00006560-M01
SLC12A4 monoclonal antibody (M01), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC12A4.
Información adicional
Size 100 ug
Gene Name SLC12A4
Gene Alias FLJ40489|KCC1
Gene Description solute carrier family 12 (potassium/chloride transporters), member 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNLALFEEELDIRPKVSSLLGKLVSYTNLTQGAKEHEEAESGEGTRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC12A4 (AAH21193, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6560
Clone Number 1H6
Iso type IgG1 kappa

Enviar uma mensagem


SLC12A4 monoclonal antibody (M01), clone 1H6

SLC12A4 monoclonal antibody (M01), clone 1H6