SLC6A11 monoclonal antibody (M10), clone 2C3
  • SLC6A11 monoclonal antibody (M10), clone 2C3

SLC6A11 monoclonal antibody (M10), clone 2C3

Ref: AB-H00006538-M10
SLC6A11 monoclonal antibody (M10), clone 2C3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC6A11.
Información adicional
Size 100 ug
Gene Name SLC6A11
Gene Alias GAT-3|GAT3
Gene Description solute carrier family 6 (neurotransmitter transporter, GABA), member 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC6A11 (NP_055044.1, 164 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6538
Clone Number 2C3
Iso type IgG2a Kappa

Enviar uma mensagem


SLC6A11 monoclonal antibody (M10), clone 2C3

SLC6A11 monoclonal antibody (M10), clone 2C3