SLC5A3 polyclonal antibody (A01)
  • SLC5A3 polyclonal antibody (A01)

SLC5A3 polyclonal antibody (A01)

Ref: AB-H00006526-A01
SLC5A3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC5A3.
Información adicional
Size 50 uL
Gene Name SLC5A3
Gene Alias SMIT|SMIT2
Gene Description solute carrier family 5 (sodium/myo-inositol cotransporter), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6526

Enviar uma mensagem


SLC5A3 polyclonal antibody (A01)

SLC5A3 polyclonal antibody (A01)