SLC4A1 purified MaxPab mouse polyclonal antibody (B01P)
  • SLC4A1 purified MaxPab mouse polyclonal antibody (B01P)

SLC4A1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00006521-B01P
SLC4A1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC4A1 protein.
Información adicional
Size 50 ug
Gene Name SLC4A1
Gene Alias AE1|BND3|CD233|DI|EMPB3|EPB3|FR|MGC116750|MGC116753|MGC126619|MGC126623|RTA1A|SW|WD|WD1|WR
Gene Description solute carrier family 4, anion exchanger, member 1 (erythrocyte membrane protein band 3, Diego blood group)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEELQDDYEDMMEENLEQEEYEDPDIHESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC4A1 (AAH99628.1, 1 a.a. ~ 911 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6521

Enviar uma mensagem


SLC4A1 purified MaxPab mouse polyclonal antibody (B01P)

SLC4A1 purified MaxPab mouse polyclonal antibody (B01P)