SLC3A1 polyclonal antibody (A01)
  • SLC3A1 polyclonal antibody (A01)

SLC3A1 polyclonal antibody (A01)

Ref: AB-H00006519-A01
SLC3A1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC3A1.
Información adicional
Size 50 uL
Gene Name SLC3A1
Gene Alias ATR1|CSNU1|D2H|FLJ34681|NBAT|RBAT
Gene Description solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC3A1 (AAH22386, 211 a.a. ~ 320 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6519

Enviar uma mensagem


SLC3A1 polyclonal antibody (A01)

SLC3A1 polyclonal antibody (A01)