View larger
Mouse monoclonal antibody raised against a partial recombinant SLC2A4.
AB-H00006517-M01
New product
SLC2A4 monoclonal antibody (M01), clone 2A4
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SLC2A4 |
| Gene Alias | GLUT4 |
| Gene Description | solute carrier family 2 (facilitated glucose transporter), member 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC2A4 (NP_001033, 467 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 6517 |
| Clone Number | 2A4 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant SLC2A4.