SLC1A2 purified MaxPab rabbit polyclonal antibody (D01P)
  • SLC1A2 purified MaxPab rabbit polyclonal antibody (D01P)

SLC1A2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00006506-D01P
SLC1A2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SLC1A2 protein.
Información adicional
Size 100 ug
Gene Name SLC1A2
Gene Alias EAAT2|GLT-1
Gene Description solute carrier family 1 (glial high affinity glutamate transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC1A2 (NP_004162.2, 1 a.a. ~ 574 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 6506

Enviar uma mensagem


SLC1A2 purified MaxPab rabbit polyclonal antibody (D01P)

SLC1A2 purified MaxPab rabbit polyclonal antibody (D01P)