SLC1A2 polyclonal antibody (A01)
  • SLC1A2 polyclonal antibody (A01)

SLC1A2 polyclonal antibody (A01)

Ref: AB-H00006506-A01
SLC1A2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SLC1A2.
Información adicional
Size 50 uL
Gene Name SLC1A2
Gene Alias EAAT2|GLT-1
Gene Description solute carrier family 1 (glial high affinity glutamate transporter), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC1A2 (NP_004162, 160 a.a. ~ 239 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6506

Enviar uma mensagem


SLC1A2 polyclonal antibody (A01)

SLC1A2 polyclonal antibody (A01)