SKP2 MaxPab rabbit polyclonal antibody (D01)
  • SKP2 MaxPab rabbit polyclonal antibody (D01)

SKP2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00006502-D01
SKP2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SKP2 protein.
Información adicional
Size 100 uL
Gene Name SKP2
Gene Alias FBL1|FBXL1|FLB1|MGC1366
Gene Description S-phase kinase-associated protein 2 (p45)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLGHPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SKP2 (NP_005974.2, 1 a.a. ~ 424 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 6502

Enviar uma mensagem


SKP2 MaxPab rabbit polyclonal antibody (D01)

SKP2 MaxPab rabbit polyclonal antibody (D01)