SKP2 polyclonal antibody (A01)
  • SKP2 polyclonal antibody (A01)

SKP2 polyclonal antibody (A01)

Ref: AB-H00006502-A01
SKP2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SKP2.
Información adicional
Size 50 uL
Gene Name SKP2
Gene Alias FBL1|FBXL1|FLB1|MGC1366
Gene Description S-phase kinase-associated protein 2 (p45)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SKP2 (AAH01441, 176 a.a. ~ 285 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 6502

Enviar uma mensagem


SKP2 polyclonal antibody (A01)

SKP2 polyclonal antibody (A01)